PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G041000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 682aa    MW: 75747.8 Da    PI: 6.3815
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G041000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-184995148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g WT++Ed+ l +avk++ g++Wk+Ia++++ gR++ qc +rwqk+l
  Aqcoe7G041000.1.p 49 KGGWTEQEDDMLTKAVKRYNGKNWKKIAECFP-GRSDVQCLHRWQKVL 95
                       688*****************************.************986 PP

2Myb_DNA-binding59.38.6e-19101147148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+W++eEde+++++v ++G + W+ Ia+ ++ gR +kqc++rw+++l
  Aqcoe7G041000.1.p 101 KGPWSKEEDERILELVDKYGCKKWSVIAQSLP-GRIGKQCRERWHNHL 147
                        79******************************.*************97 PP

3Myb_DNA-binding51.81.8e-16155195345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        +WT+eE++ l++a++ +G++ W+ Ia+ ++ gR ++++k++w+
  Aqcoe7G041000.1.p 155 AWTKEEELALIQAHQIYGNK-WAEIAKFLP-GRADNSIKNHWN 195
                        7*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2314495IPR017930Myb domain
SuperFamilySSF466893.01E-1647102IPR009057Homeodomain-like
SMARTSM007171.1E-164897IPR001005SANT/Myb domain
PfamPF002494.3E-164995IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2251107IPR009057Homeodomain-like
CDDcd001672.66E-145295No hitNo description
PROSITE profilePS5129430.99396151IPR017930Myb domain
SuperFamilySSF466895.24E-3298194IPR009057Homeodomain-like
SMARTSM007173.5E-16100149IPR001005SANT/Myb domain
PfamPF002499.4E-18101147IPR001005SANT/Myb domain
CDDcd001674.98E-15103147No hitNo description
Gene3DG3DSA:1.10.10.602.3E-26108154IPR009057Homeodomain-like
PROSITE profilePS5129420.615152202IPR017930Myb domain
SMARTSM007179.8E-16152200IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-22155202IPR009057Homeodomain-like
CDDcd001671.51E-12155195No hitNo description
PfamPF002496.4E-15155195IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MEVVKKEDTN VVTVAALSSP ISNISLDTAL PKLASVQGRT TGPTRRSTKG GWTEQEDDML  60
TKAVKRYNGK NWKKIAECFP GRSDVQCLHR WQKVLNPDLV KGPWSKEEDE RILELVDKYG  120
CKKWSVIAQS LPGRIGKQCR ERWHNHLNPA IKKHAWTKEE ELALIQAHQI YGNKWAEIAK  180
FLPGRADNSI KNHWNCSVKK KLDSYLASGF AGDLGINAYD SYNNEWKDGT IKLEVSAHDQ  240
EISCPLDPKK DSDDDIDFSL GVSVHELSCD EQKDIQSHLE PIQQENRCFK EEIDCQKELP  300
IRIHFECGRP SFECGRPSAR KLSTELLGED ANYDCTSDDV HHSSVETEVS CGISSRDFNS  360
SPRFSKELSL SLSSFGDPLD GMSGWKNGLS PDIPHPFATR RTPETPKRPR HYASCLHEFG  420
DLNSKSSVEC YTLFPNLLSG DCGHENGRAQ RKGQLVTTRL QSEDISFGPL FYEPPEQTNP  480
GVVVKNVQLE DSPLSCSTPP SSIGSISVNG RTPETILRTA AKNFKYTPSI IRKRARGTSG  540
QGCNANDFND VCMSEVKSGS STDTQGSPYS CDRVLAGQKN LTRAHLLDGK WLSLSMPSLQ  600
PELDVSTKAV EKCLEHAFDL AWDNSKAKCS DTVSESDSIS EISTSNIDLM PPNKSADSSR  660
ERTNHNFLML SLGINCVCDL N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C3e-67492026159MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-67492026159MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255475.11e-176PREDICTED: uncharacterized protein LOC104596138
RefseqXP_010255474.11e-176PREDICTED: uncharacterized protein LOC104596138
RefseqXP_010255473.11e-176PREDICTED: uncharacterized protein LOC104596138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.17e-96Homeodomain-like protein